TGF beta induced factor 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56813

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TGF beta induced factor 2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TGF beta induced factor 2 Antibody [NBP2-56813]

Immunocytochemistry/ Immunofluorescence: TGF beta induced factor 2 Antibody [NBP2-56813]

Immunocytochemistry/Immunofluorescence: TGF beta induced factor 2 Antibody [NBP2-56813] - Staining of human cell line CACO-2 shows localization to nucleoplasm.
TGF beta induced factor 2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: TGF beta induced factor 2 Antibody - BSA Free [NBP2-56813]

Chromatin Immunoprecipitation-exo-Seq: TGF beta induced factor 2 Antibody - BSA Free [NBP2-56813]

ChIP-Exo-Seq composite graph for Anti-TGIF2 (NBP2-56813) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for TGF beta induced factor 2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TGF beta induced factor 2

TGF beta induced factor 2 is encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor. The encoded protein appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and overexpressed in some ovarian cancers, and mutations in this gene can cause holoprosencephaly.

Alternate Names

homeobox protein TGIF2, TGF(beta)-induced transcription factor 2, TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2, TGFB-induced factor 2, TGFB-induced factor 2 (TALE family homeobox), TGFB-induced factor homeobox 2, transcription growth factor-beta-induced factor 2

Gene Symbol

TGIF2

Additional TGF beta induced factor 2 Products

Product Documents for TGF beta induced factor 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TGF beta induced factor 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TGF beta induced factor 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TGF beta induced factor 2 Antibody - BSA Free and earn rewards!

Have you used TGF beta induced factor 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...