THSD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25189

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein THSD1 using the following amino acid sequence: KSQARHVGSRGGPSERSHARNAHFRRTASFHEARQARPFRERSMSTLTPRQAPAYSSRTRTCEQAEDRFRPQSRGAHLFPEKLEHFQEASGTRGPLN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for THSD1 Antibody - BSA Free

THSD1 Antibody Immunohistochemistry-Paraffin: THSD1 Antibody [NBP3-25189]

Immunohistochemistry-Paraffin: THSD1 Antibody [NBP3-25189]

Staining of human colon shows shows strong cytoplasmic positivity in endothelial cells.

Applications for THSD1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: THSD1

Mouse THSD1 (Thrombospondin type-1 domain-containing protein 1), also known as Transmembrane molecule with thrombospondin module (Tmtsp), is a 95 kDa, type I transmembrane protein. It is synthesized as a precursor that is 851 amino acids (aa) in length, and has a 24 aa signal sequence, a 388 aa extracellular region, a 21 aa transmembrane region, and a 418 aa cytoplasmic region. The extracellular region contains six potential N-linked glycosylation sites and the thrombospondin type-1 (TSP1) domain, which is implicated in cell adhesion and migration. Also present in the molecule are 9 PKC-phosphorylation sites, 3 Ig-like domains, and a tyrosine-phosphorylation site by its C-terminus. Mouse THSD1 shares 78% aa sequence identity with human THSD1. THSD1 is highly expressed in hematopoietic stem cells (HSCs) and progenitor cells, including CD34-/lowKit+Sca-1+Lin- HSCs, CD34+Kit+Sca-1+Lin- and Lin- progenitor cells, and to a lesser degree in thymic CD4-CD8- cells. Expression gradually decreases during T cell differentiation. In addition, THSD1 is widely expressed on endothelial cells, with highest expression in the lung. THSD1's ligand and function are unknown, but it is postulated that THSD1 may be involved in the regulation of vasculogenesis and/or angiogenesis through its interaction with its specific ligand. THSD1 may function in primitive hematopoietic cells in the bone marrow niche, and through its TSP1 and Ig-like domains, it may play a role in HSC homing to the niche following cell-to-cell contact to maintain hematopoietic stem cell quiescence.

Long Name

Thrombospondin, Type I, Domain Containing 1

Alternate Names

TMTSP

Gene Symbol

THSD1

Additional THSD1 Products

Product Documents for THSD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for THSD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for THSD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review THSD1 Antibody - BSA Free and earn rewards!

Have you used THSD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...