Thyroid Peroxidase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25190

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Thyroid Peroxidase Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein Thyroid Peroxidase using the following amino acid sequence: STVICRWTRTGTKSTLPISETGGGTPELRCGKHQAVGTSPQRAAAQDSEQESAGMEGRDTHRLPRA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Thyroid Peroxidase Antibody - BSA Free

Thyroid Peroxidase Antibody Immunohistochemistry-Paraffin: Thyroid Peroxidase Antibody [NBP3-25190]

Immunohistochemistry-Paraffin: Thyroid Peroxidase Antibody [NBP3-25190]

Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Applications for Thyroid Peroxidase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Thyroid Peroxidase

Thyroid Peroxidase encodes a membrane-bound glycoprotein. The encoded protein acts as an enzyme and plays a central role in thyroid gland function. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. Mutations in this gene are associated with several disorders of thyroid hormonogenesis, including congenital hypothyroidism, congenital goiter, and thyroid hormone organification defect IIA. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional splice variants have been described but their biological natures have not been determined. [provided by RefSeq]

Alternate Names

EC 1.11.1, MSA, TDH2A, thyroid microsomal antigen, thyroid peroxidase, thyroperoxidase, TPXEC 1.11.1.8

Gene Symbol

TPO

Additional Thyroid Peroxidase Products

Product Documents for Thyroid Peroxidase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Thyroid Peroxidase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Thyroid Peroxidase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Thyroid Peroxidase Antibody - BSA Free and earn rewards!

Have you used Thyroid Peroxidase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies