Thyroid receptor-interacting protein 11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57415

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Thyroid receptor-interacting protein 11 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Thyroid receptor-interacting protein 11 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Thyroid receptor-interacting protein 11 Antibody [NBP2-57415]

Immunocytochemistry/ Immunofluorescence: Thyroid receptor-interacting protein 11 Antibody [NBP2-57415]

Immunocytochemistry/Immunofluorescence: Thyroid receptor-interacting protein 11 Antibody [NBP2-57415] - Staining of human cell line HaCaT shows localization to nuclear speckles & the Golgi apparatus.

Applications for Thyroid receptor-interacting protein 11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Thyroid receptor-interacting protein 11

TRIP11/TRIP230 was identified as a co-activator of the thyroid hormone receptor (TR). TRIP230 has also been identified as an essential coactivator of AHR (aryl-hydrocarbon receptor) and HIF (hypoxia inducible factor). Additionally, TRIP11/TRIP230 has been observed to play a role in maintaining cis-Golgi structure.

Alternate Names

CEV14TR-interacting protein 11, Clonal evolution-related gene on chromosome 14 protein, GMAP-210ACG1A, Golgi-associated microtubule-binding protein 210, Golgi-microtubule-associated protein of 210 kDa, thyroid hormone receptor interactor 11, thyroid receptor-interacting protein 11, TRIP-11, Trip230

Gene Symbol

TRIP11

Additional Thyroid receptor-interacting protein 11 Products

Product Documents for Thyroid receptor-interacting protein 11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Thyroid receptor-interacting protein 11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Thyroid receptor-interacting protein 11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Thyroid receptor-interacting protein 11 Antibody - BSA Free and earn rewards!

Have you used Thyroid receptor-interacting protein 11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies