TIMM29 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-94151

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TIMM29 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TIMM29 Antibody [NBP1-94151]

Immunocytochemistry/ Immunofluorescence: TIMM29 Antibody [NBP1-94151]

Immunocytochemistry/Immunofluorescence: TIMM29 Antibody [NBP1-94151] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TIMM29 Antibody [NBP1-94151]

Immunohistochemistry-Paraffin: TIMM29 Antibody [NBP1-94151]

Immunohistochemistry-Paraffin: TIMM29 Antibody [NBP1-94151] - Staining of human duodenum shows strong nuclear positivity in glandular cells.
Western Blot: TIMM29 Antibody [NBP1-94151]

Western Blot: TIMM29 Antibody [NBP1-94151]

Western Blot: TIMM29 Antibody [NBP1-94151] - Analysis in human cell line PC-3.
Immunohistochemistry-Paraffin: TIMM29 Antibody [NBP1-94151]

Immunohistochemistry-Paraffin: TIMM29 Antibody [NBP1-94151]

Immunohistochemistry-Paraffin: TIMM29 Antibody [NBP1-94151] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: TIMM29 Antibody [NBP1-94151]

Immunohistochemistry-Paraffin: TIMM29 Antibody [NBP1-94151]

Immunohistochemistry-Paraffin: TIMM29 Antibody [NBP1-94151] - Staining of human placenta shows strong nuclear positivity in trophloblastic cells.
TIMM29 Antibody - BSA Free Immunohistochemistry: TIMM29 Antibody - BSA Free [NBP1-94151]

Immunohistochemistry: TIMM29 Antibody - BSA Free [NBP1-94151]

Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
TIMM29 Antibody - BSA Free Immunohistochemistry: TIMM29 Antibody - BSA Free [NBP1-94151]

Immunohistochemistry: TIMM29 Antibody - BSA Free [NBP1-94151]

Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
TIMM29 Antibody - BSA Free Western Blot: TIMM29 Antibody - BSA Free [NBP1-94151]

Western Blot: TIMM29 Antibody - BSA Free [NBP1-94151]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
TIMM29 Antibody - BSA Free Western Blot: TIMM29 Antibody - BSA Free [NBP1-94151]

Western Blot: TIMM29 Antibody - BSA Free [NBP1-94151]

Analysis in human cell line PC-3.

Applications for TIMM29 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500-1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TIMM29

Alternate Names

chromosome 19 open reading frame 52, hypothetical protein LOC90580

Gene Symbol

TIMM29

Additional TIMM29 Products

Product Documents for TIMM29 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TIMM29 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TIMM29 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TIMM29 Antibody - BSA Free and earn rewards!

Have you used TIMM29 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...