TIMM8B Antibody (8E5) - Azide and BSA Free

Novus Biologicals | Catalog # H00026521-M15

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Western Blot, ELISA

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 8E5

Format

Azide and BSA Free
View all TIMM8B Primary Antibodies »

Product Specifications

Immunogen

TIMM8B (NP_036591.1, 1 a.a. ~ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for TIMM8B Antibody (8E5) - Azide and BSA Free

Western Blot: TIMM8B Antibody (8E5) [H00026521-M15]

Western Blot: TIMM8B Antibody (8E5) [H00026521-M15]

Western Blot: TIMM8B Antibody (8E5) [H00026521-M15] - Analysis of TIMM8B expression in transfected 293T cell line by TIMM8B monoclonal antibody (M15), clone 8E5. Lane 1: TIMM8B transfected lysatE (9.3 KDa). Lane 2: Non-transfected lysate.
Western Blot: TIMM8B Antibody (8E5) [H00026521-M15]

Western Blot: TIMM8B Antibody (8E5) [H00026521-M15]

TIMM8B-Antibody-8E5-Western-Blot-H00026521-M15-img0004.jpg
ELISA: TIMM8B Antibody (8E5) [H00026521-M15]

ELISA: TIMM8B Antibody (8E5) [H00026521-M15]

ELISA: TIMM8B Antibody (8E5) [H00026521-M15] - Detection limit for recombinant GST tagged TIMM8B is 0.3 ng/ml as a capture antibody.
TIMM8B Antibody (8E5)

Western Blot: TIMM8B Antibody (8E5) [H00026521-M15] -

Western blot analysis of MRPL18 (A), TIMM8B (B), and EIF1A (C) from in vitro experiments using a normal colon mucosa epithelial cell line exposed to high (HG) or NG condition. Relative densitometric quantification and representative immunoblots are shown. CO: (osmotic) control. Error bars indicate SEM. Mann–Whitney statistical U‐test used with three biologically independent replicates included (*P‐value < 0.05).
TIMM8B Antibody (8E5)

Western Blot: TIMM8B Antibody (8E5) [H00026521-M15] -

Western Blot: TIMM8B Antibody (8E5) [H00026521-M15] - Western blot analysis of MRPL18 (A), TIMM8B (B), & EIF1A (C) from in vitro experiments using a normal colon mucosa epithelial cell line exposed to high (HG) or NG condition. Relative densitometric quantification & representative immunoblots are shown. CO: (osmotic) control. Error bars indicate SEM. Mann–Whitney statistical U‐test used with three biologically independent replicates included (*P‐value < 0.05). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31199051), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for TIMM8B Antibody (8E5) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for ELISA, Western Blot

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TIMM8B

TIMM8B belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM]

Alternate Names

DDP2DDP-like protein, DDPL, Deafness dystonia protein 2, FLJ21744, MGC102866, MGC117373, mitochondrial import inner membrane translocase subunit Tim8 B, TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B, translocase of inner mitochondrial membrane 8 homolog B (yeast)

Gene Symbol

TIMM8B

UniProt

NP_036591 (Human)

Additional TIMM8B Products

Product Documents for TIMM8B Antibody (8E5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TIMM8B Antibody (8E5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TIMM8B Antibody (8E5) - Azide and BSA Free

Customer Reviews for TIMM8B Antibody (8E5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TIMM8B Antibody (8E5) - Azide and BSA Free and earn rewards!

Have you used TIMM8B Antibody (8E5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies