TJP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38696

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VMVNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQRVEEVDQGRGYDGDSSSGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TJP3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TJP3 Antibody [NBP2-38696]

Immunocytochemistry/ Immunofluorescence: TJP3 Antibody [NBP2-38696]

Immunocytochemistry/Immunofluorescence: TJP3 Antibody [NBP2-38696] - Staining of human cell line CACO-2 shows positivity in cell junctions and nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human Small intestine shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human fallopian tube shows moderate cell membrane positivity in glandular cells.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining in human fallopian tube and prostate tissues using anti-TJP3 antibody. Corresponding TJP3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Analysis in human small intestine and cerebral cortex tissues using NBP2-38696 antibody. Corresponding TJP3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human Cerebral cortex shows very weak membranous positivity in neuronal cells.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696]

Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human Endometrium shows strong membranous positivity in glandular cells.

Applications for TJP3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TJP3

TJP3 - tight junction protein 3 (zona occludens 3)

Alternate Names

MGC119546, Tight junction protein 3, tight junction protein 3 (zona occludens 3), ZO-3, ZO3tight junction protein ZO-3, zona occludens 3, Zona occludens protein 3, Zonula occludens protein 3

Gene Symbol

TJP3

UniProt

Additional TJP3 Products

Product Documents for TJP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TJP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TJP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TJP3 Antibody - BSA Free and earn rewards!

Have you used TJP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...