TM2D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55760

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TM2D1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GSPNVIPRAHGQKNTRRDGTGLYPMRGPFKNLAL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TM2D1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TM2D1 Antibody [NBP2-55760]

Immunocytochemistry/ Immunofluorescence: TM2D1 Antibody [NBP2-55760]

Immunocytochemistry/Immunofluorescence: TM2D1 Antibody [NBP2-55760] - Staining of human cell line HEK 293 shows localization to nucleus.

Applications for TM2D1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TM2D1

The protein encoded by the TM2D1 gene is a beta-amyloid peptide-binding protein. It contains a structural module related tothat of the seven transmembrane domain G protein-coupled receptor superfamily and known to be important inheterotrimeric G protein activation. Beta-amyloid peptide has been established to be a causative factor in neurondeath and the consequent diminution of cognitive abilities observed in Alzheimer's disease. This protein may be atarget of neurotoxic beta-amyloid peptide, and may mediate cellular vulnerability to beta-amyloid peptide toxicitythrough a G protein-regulated program of cell death. (provided by RefSeq)

Alternate Names

BBPBeta-amyloid-binding protein, hBBP, TM2 domain containing 1, TM2 domain-containing protein 1

Gene Symbol

TM2D1

Additional TM2D1 Products

Product Documents for TM2D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TM2D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TM2D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TM2D1 Antibody - BSA Free and earn rewards!

Have you used TM2D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies