TMEM205 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81255

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RTTAAMWALQTVEKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TMEM205 Antibody - BSA Free

Western Blot: TMEM205 Antibody [NBP1-81255]

Western Blot: TMEM205 Antibody [NBP1-81255]

Western Blot: TMEM205 Antibody [NBP1-81255] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: TMEM205 Antibody [NBP1-81255]

Immunocytochemistry/ Immunofluorescence: TMEM205 Antibody [NBP1-81255]

Immunocytochemistry/Immunofluorescence: TMEM205 Antibody [NBP1-81255] - Staining of human cell line MCF7 shows localization to nucleoplasm, nuclear membrane & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255]

Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255]

Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255]

Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255]

Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.
Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255]

Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255]

Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255]

Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255]

Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255]

Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255]

Immunohistochemistry-Paraffin: TMEM205 Antibody [NBP1-81255] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Applications for TMEM205 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMEM205

Alternate Names

MBC3205, MGC110858, MGC3205, transmembrane protein 205, UNQ501

Gene Symbol

TMEM205

Additional TMEM205 Products

Product Documents for TMEM205 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TMEM205 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TMEM205 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMEM205 Antibody - BSA Free and earn rewards!

Have you used TMEM205 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...