TMEM41B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81552

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TMEM41B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit TMEM41B Antibody - BSA Free (NBP1-81552) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-TMEM41B Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for TMEM41B Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: TMEM41B Antibody [NBP1-81552]

Immunocytochemistry/ Immunofluorescence: TMEM41B Antibody [NBP1-81552]

Immunocytochemistry/Immunofluorescence: TMEM41B Antibody [NBP1-81552] - Staining of human cell line A-431 shows localization to peroxisomes.
Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552]

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552]

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552] - Staining of human Skeletal muscle shows no granular cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552]

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552]

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552] - Staining of human cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552]

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552]

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552] - Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552]

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552]

Immunohistochemistry-Paraffin: TMEM41B Antibody [NBP1-81552] - Staining of human Testis shows moderate granular cytoplasmic positivity in Leydig cells.

Applications for TMEM41B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20-1:50

Immunohistochemistry-Paraffin

1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMEM41B

Transmembrane protein 41B/Stasimon (human TMEM41B theoretical molecular weight 32.5 kDa) is an integral endoplasmic reticulum membrane protein that plays a role in autophagy and neurogenesis (1). TMEM41B forms a complex with vacuole membrane protein 1 (VMP1) and is required for autophagosome formation. Similar to VMP1, TMEM41B contains a VTT domain. Expression of TMEM41B/Stasimon restores motor neuron function defects in Drosophila and zebrafish models of spinal muscular atrophy (SMA). Survival motor neuron protein (SMN) deficiency, which underscores the neuromuscular disorder SMA, affects TMEM41B/Stasimon U12 splicing and mRNA expression (2,3).

1. Stavoe, A. K. H., & Holzbaur, E. L. F. (2019). Autophagy in Neurons. Annual Review of Cell and Developmental Biology. https://doi.org/10.1146/annurev-cellbio-100818-125242

2. Doktor, T. K., Hua, Y., Andersen, H. S., Br0ner, S., Liu, Y. H., Wieckowska, A., Andresen, B. S. (2017). RNA-sequencing of a mouse-model of spinal muscular atrophy reveals tissue-wide changes in splicing of U12-dependent introns. Nucleic Acids Research. https://doi.org/10.1093/nar/gkw731

3. Hosseinibarkooie, S., Schneider, S., & Wirth, B. (2017). Advances in understanding the role of disease-associated proteins in spinal muscular atrophy. Expert Review of Proteomics. https://doi.org/10.1080/14789450.2017.1345631

Long Name

Transmembrane Protein 41B

Alternate Names

KIAA0033, Stasimon

Gene Symbol

TMEM41B

Additional TMEM41B Products

Product Documents for TMEM41B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TMEM41B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Infectious Diseases

Citations for TMEM41B Antibody - BSA Free

Customer Reviews for TMEM41B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMEM41B Antibody - BSA Free and earn rewards!

Have you used TMEM41B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies