TMPRSS2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-38263
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This TMPRSS2 Antibody was developed against a recombinant protein corresponding to amino acids: GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
53.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for TMPRSS2 Antibody - BSA Free
Western Blot: TMPRSS2 Antibody [NBP2-38263]
Western Blot: TMPRSS2 Antibody [NBP2-38263] - Analysis in control (vector only transfected HEK293T lysate) and TMPRSS2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263]
Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human endometrium shows no positivity in glandular cells as expected.Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263]
Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human kidney shows strong membranous and secretion positivity in cells in tubules.Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263]
Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human prostate shows strong membranous positivity in glandular cells.Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263]
Immunohistochemistry-Paraffin: TMPRSS2 Antibody [NBP2-38263] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.Applications for TMPRSS2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04 - 0.4 ug/ml
Application Notes
Use in ICC/IF reported in scientific literature (PMID:33526471) For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TMPRSS2
TMPRSS2 has also been shown to play a critical role in the process of viral entry for coronaviruses and influenza viruses thru proteolytic activation of key viral glycoproteins. One pathway for SARS-CoV-2 infection, which causes the COVID-19 disease, involves binding of the SARS-CoV-2 Spike 'S' glycoprotein to the human ACE2 receptor and cleavage of S by TMPRSS2 at the cell surface to facilitate viral entry. TMPRSS2 mediates viral entry in a similar mechanism for other coronaviruses such as SARS-CoV and MERS. The broad-spectrum serine protease inhibitor, Camostat, is a TMPRSS2 inhibitor demonstrated to protect mice with lethal SARS-CoV infections (3).
References
1. Clark, J., Cooper, C. (2009) ETS gene fusions in prostate cancer. Nat Rev Urol 6, 429-439. PMID: 19657377
2. Duffy, MJ. (2014) Chapter One - PSA in Screening for Prostate Cancer: More Good than Harm or More Harm than Good? Adv Clin Chem. 66:1-23. PMID: 25344984
3. Shen LW, Mao HJ, Wu YL, Tanaka Y, Zhang W. (2017) TMPRSS2: A potential target for treatment of influenza virus and coronavirus infections. Biochimie. 142:1-10
Long Name
Transmembrane protease, serine 2
Alternate Names
Epitheliasin, PP9284, PRSS10
Gene Symbol
TMPRSS2
UniProt
Additional TMPRSS2 Products
Product Documents for TMPRSS2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TMPRSS2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for TMPRSS2 Antibody - BSA Free
Customer Reviews for TMPRSS2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review TMPRSS2 Antibody - BSA Free and earn rewards!
Have you used TMPRSS2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...