TMX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49405

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TMX2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TMX2 Antibody - BSA Free

Western Blot: TMX2 Antibody [NBP2-49405]

Western Blot: TMX2 Antibody [NBP2-49405]

Western Blot: TMX2 Antibody [NBP2-49405] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Immunocytochemistry/ Immunofluorescence: TMX2 Antibody [NBP2-49405]

Immunocytochemistry/ Immunofluorescence: TMX2 Antibody [NBP2-49405]

Immunocytochemistry/Immunofluorescence: TMX2 Antibody [NBP2-49405] - Staining of human cell line HaCaT shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405]

Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405]

Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405] - Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules and glomeruli.
Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405]

Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405]

Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405] - Staining of human colon shows moderate cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405]

Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405]

Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405] - Staining of human Cerebral cortex shows moderate granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405]

Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405]

Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405] - Staining of human Duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405]

Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405]

Immunohistochemistry-Paraffin: TMX2 Antibody [NBP2-49405] - Staining of human Testis shows moderate granular cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.

Applications for TMX2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Western Blot

1:100 - 1:250
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMX2

TMX2 is a gene that codes for a widely expressed single-pass type 1 membrane protein that has two isoforms, with lengths of 296 and 258 amino acids, and weights of approximately 34 and 30 kDa respectively. TMX2 has been shown to have interactions with COMMD8, TMX1, TMX3, CANX, and TMX4.

Alternate Names

Cell proliferation-inducing gene 26 protein, DKFZp781O2021, growth-inhibiting gene 11, MGC111151, PDIA12, PIG26, protein disulfide isomerase family A, member 12, thioredoxin domain containing 14, Thioredoxin domain-containing protein 14, thioredoxin-related transmembrane protein 2, TXNDC14

Gene Symbol

TMX2

Additional TMX2 Products

Product Documents for TMX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TMX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TMX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMX2 Antibody - BSA Free and earn rewards!

Have you used TMX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies