TNIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89306

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TNIP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDNELLPP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TNIP1 Antibody - BSA Free

Western Blot: TNIP1 Antibody [NBP1-89306]

Western Blot: TNIP1 Antibody [NBP1-89306]

Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western Blot: TNIP1 Antibody [NBP1-89306]

Western Blot: TNIP1 Antibody [NBP1-89306]

Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis using Anti-TNIP1 antibody NBP1-89306 (A) shows similar pattern to independent antibody NBP2-32705 (B).
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306]

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306]

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Western Blot: TNIP1 Antibody [NBP1-89306]

Western Blot: TNIP1 Antibody [NBP1-89306]

Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in human cell line A-431.
Western Blot: TNIP1 Antibody [NBP1-89306]

Western Blot: TNIP1 Antibody [NBP1-89306]

Western Blot: TNIP1 Antibody [NBP1-89306] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306]

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306]

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306]

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306]

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306]

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306]

Immunohistochemistry-Paraffin: TNIP1 Antibody [NBP1-89306] - Staining of human Testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Applications for TNIP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TNIP1

Interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal. Increases cell surface CD4(T4) antigen expression. Interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. May regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production

Alternate Names

ABIN-1, HIV-1 Nef-interacting protein, hVAN, KIAA0113nip40-1, Naf1, NAF1TNFAIP3-interacting protein 1, Nef-associated factor 1, Nef-associated factor 1 SNP, Nip40-1, TNFAIP3 interacting protein 1, VANvirion-associated nuclear-shuttling protein, Virion-associated nuclear shuttling protein

Gene Symbol

TNIP1

Additional TNIP1 Products

Product Documents for TNIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TNIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TNIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TNIP1 Antibody - BSA Free and earn rewards!

Have you used TNIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies