TPD52L1/D53 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84314

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TPD52L1/D53 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TPD52L1/D53 Antibody - BSA Free

Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84314]

Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84314]

Immunohistochemistry-Paraffin: TPD52L1/D53 Antibody [NBP1-84314] - Staining of human salivary gland shows distinct cytoplasmic positivity in glandular cells.
TPD52L1/D53 Antibody - BSA Free Western Blot: TPD52L1/D53 Antibody - BSA Free [NBP1-84314]

Western Blot: TPD52L1/D53 Antibody - BSA Free [NBP1-84314]

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line MCF-7

Applications for TPD52L1/D53 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TPD52L1/D53

TPD52L1/D53 encodes a member of the tumor protein D52 (TPD52) family. The encoded protein contains a coiled-coil domain and may form homo- or hetero-dimer with TPD52 family members. The protein is reported to be involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed, but the full-length nature of some variants has not yet been determined. [provided by RefSeq]

Alternate Names

D53, MGC8556, tumor protein D52-like 1hD53TPD52L2, tumor protein D52-like 2, tumor protein D53

Gene Symbol

TPD52L1

Additional TPD52L1/D53 Products

Product Documents for TPD52L1/D53 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TPD52L1/D53 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TPD52L1/D53 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TPD52L1/D53 Antibody - BSA Free and earn rewards!

Have you used TPD52L1/D53 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies