TPD52L3/D55 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35573

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human TPD52L3/D55 (NP_001001875.1).

Sequence:
MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGNPKGEGSRI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TPD52L3/D55 Antibody - BSA Free

TPD52L3/D55 Antibody

Western Blot: TPD52L3/D55 Antibody [NBP3-35573] -

Western Blot: TPD52L3/D55 Antibody [NBP3-35573] - Western blot analysis of various lysates using TPD52L3/D55 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30S.
TPD52L3/D55 Antibody

Immunocytochemistry/ Immunofluorescence: TPD52L3/D55 Antibody [NBP3-35573] -

Immunocytochemistry/ Immunofluorescence: TPD52L3/D55 Antibody [NBP3-35573] - Immunofluorescence analysis of paraffin-embedded mouse testis using TPD52L3/D55 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
TPD52L3/D55 Antibody

Immunocytochemistry/ Immunofluorescence: TPD52L3/D55 Antibody [NBP3-35573] -

Immunocytochemistry/ Immunofluorescence: TPD52L3/D55 Antibody [NBP3-35573] - Immunofluorescence analysis of paraffin-embedded rat testis using TPD52L3/D55 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for TPD52L3/D55 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:200 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TPD52L3/D55

The Tumor protein D52 like 3 gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by anN-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-likeproteins. The encoded pro

Alternate Names

hD55, MGC26757, NYDSP25, NYD-SP25, protein kinase NYD-SP25, Testis development protein NYD-SP25, tumor protein D52-like 3MGC45374, tumor protein D55

Gene Symbol

TPD52L3

Additional TPD52L3/D55 Products

Product Documents for TPD52L3/D55 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TPD52L3/D55 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TPD52L3/D55 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TPD52L3/D55 Antibody - BSA Free and earn rewards!

Have you used TPD52L3/D55 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...