TRAF3IP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38330

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human TRAF3IP2 (NP_671733.2).

Sequence:
MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TRAF3IP2 Antibody - BSA Free

TRAF3IP2 Antibody

Western Blot: TRAF3IP2 Antibody [NBP3-38330] -

Western Blot: TRAF3IP2 Antibody [NBP3-38330] - Western blot analysis of lysates from Rat lung, using TRAF3IP2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
TRAF3IP2 Antibody

Western Blot: TRAF3IP2 Antibody [NBP3-38330] -

Western Blot: TRAF3IP2 Antibody [NBP3-38330] - Western blot analysis of various lysates using TRAF3IP2 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
TRAF3IP2 Antibody

Immunocytochemistry/ Immunofluorescence: TRAF3IP2 Antibody [NBP3-38330] -

Immunocytochemistry/ Immunofluorescence: TRAF3IP2 Antibody [NBP3-38330] - Immunofluorescence analysis of Hep G2 cells using TRAF3IP2 Rabbit pAbat a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for TRAF3IP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TRAF3IP2

TRAF3IP2 encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Two alternative transcripts encoding different proteins have been identified. A third transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene.

Alternate Names

ACT1DKFZP586G0522, adapter protein CIKS, C6orf2, C6orf4chromosome 6 open reading frame 5, C6orf5DKFZp586G0522, C6orf6MGC3581, CIKSchromosome 6 open reading frame 2, Connection to IKK and SAPK/JNK, NFkB-activating protein ACT1, Nuclear factor NF-kappa-B activator 1, TRAF3 interacting protein 2, TRAF3-interacting protein 2

Gene Symbol

TRAF3IP2

Additional TRAF3IP2 Products

Product Documents for TRAF3IP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRAF3IP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRAF3IP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRAF3IP2 Antibody - BSA Free and earn rewards!

Have you used TRAF3IP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...