Transaldolase 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56305

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Transaldolase 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Transaldolase 1 Antibody - BSA Free

Western Blot: Transaldolase 1 Antibody [NBP2-56305]

Western Blot: Transaldolase 1 Antibody [NBP2-56305]

Western Blot: Transaldolase 1 Antibody [NBP2-56305] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Transaldolase 1 Antibody [NBP2-56305]

Immunocytochemistry/ Immunofluorescence: Transaldolase 1 Antibody [NBP2-56305]

Immunocytochemistry/Immunofluorescence: Transaldolase 1 Antibody [NBP2-56305] - Staining of human cell line A549 shows localization to nucleoplasm & cytosol.

Applications for Transaldolase 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Transaldolase 1

Transaldolase 1 is a key enzyme of the nonoxidative pentose phosphate pathway providing ribose-5-phosphate for nucleic acid synthesis and NADPH for lipid biosynthesis. This pathway can also maintain glutathione at a reduced state and thus protect sulfhydryl groups and cellular integrity from oxygen radicals. The functional gene of transaldolase 1 is located on chromosome 11 and a pseudogene is identified on chromosome 1 but there are conflicting map locations. The second and third exon of this gene were developed by insertion of a retrotransposable element. This gene is thought to be involved in multiple sclerosis. [provided by RefSeq]

Alternate Names

dihydroxyacetone transferase, EC 2.2.1.2, glycerone transferase, TAL, TALDO, TALDOR, TALH, TAL-H, transaldolase, transaldolase 1

Gene Symbol

TALDO1

Additional Transaldolase 1 Products

Product Documents for Transaldolase 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Transaldolase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Transaldolase 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Transaldolase 1 Antibody - BSA Free and earn rewards!

Have you used Transaldolase 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies