TRBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13411

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: TVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAAT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TRBP Antibody - BSA Free

Western Blot: TRBP Antibody [NBP2-13411]

Western Blot: TRBP Antibody [NBP2-13411]

Western Blot: TRBP Antibody [NBP2-13411] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-13411]

Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-13411]

Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-13411] - Staining of human placenta shows strong positivity.
TRBP Antibody - BSA Free Immunohistochemistry: TRBP Antibody - BSA Free [NBP2-13411]

Immunohistochemistry: TRBP Antibody - BSA Free [NBP2-13411]

Staining of human placenta shows strong positivity.
TRBP Antibody - BSA Free Western Blot: TRBP Antibody - BSA Free [NBP2-13411]

Western Blot: TRBP Antibody - BSA Free [NBP2-13411]

Analysis in human cell line HEK 293.
TRBP Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: TRBP Antibody - BSA Free [NBP2-13411]

Immunocytochemistry/ Immunofluorescence: TRBP Antibody - BSA Free [NBP2-13411]

Staining of human cell line MCF7 shows localization to nucleoplasm.

Applications for TRBP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF,Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRBP

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene also has a pseudogene.

Alternate Names

LOQS, RISC-loading complex subunit TARBP2, TAR (HIV) RNA binding protein 2, TAR (HIV) RNA-binding protein 2, TAR (HIV) RNA-binding protein TRBP1, TAR (HIV-1) RNA binding protein 2, TAR RNA binding protein 2, TAR RNA-binding protein 2, trans-activation responsive RNA-binding protein, Trans-activation-responsive RNA-binding protein, TRBP, TRBP1, TRBP2

Gene Symbol

TARBP2

Additional TRBP Products

Product Documents for TRBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRBP Antibody - BSA Free and earn rewards!

Have you used TRBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...