Trypsin 1/PRSS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-46871

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Trypsin 1/PRSS1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RIQVRLGEHNIEVLEGNEQFINAAKIIRHP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Trypsin 1/PRSS1 Antibody - BSA Free

Trypsin 1/PRSS1 Antibody

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] - Analysis in human pancreas and cerebral cortex tissues using NBP2-46871 antibody. Corresponding PRSS1 RNA-seq data are presented for the same tissues.
Trypsin 1/PRSS1 Antibody

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Trypsin 1/PRSS1 Antibody

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -Staining of human duodenum shows strong cytoplasmic positivity in Paneth cells.
Trypsin 1/PRSS1 Antibody

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -Staining of human cerebral cortex shows no positivity in neuronal cells as expected.
Trypsin 1/PRSS1 Antibody

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -

Immunohistochemistry-Paraffin: Trypsin 1/PRSS1 Antibody [NBP2-46871] -Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Applications for Trypsin 1/PRSS1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Trypsin 1/PRSS1

Human Trypsin 1, encoded by the PRSS1 gene, is also known as cationic trypsinogen (1). Constituting approximately two-thirds of the total trypsin content in normal pancreatic juice, it is the most abundant trypsin isoform produced by the pancreas. It contains a signal peptide (residues 1-15), a pro region (residues 16-23), and a mature chain (residues 24-247). Trypsin 1 is synthesized in the pancreas and secreted into the duodenum lumen, where it is activated by enterokinase. Its major physiologic function is to digest food and to activate other pro-enzymes (2). Mutations in the PRSS1 gene can cause hereditary pancreatitis (3).

Alternate Names

PRSS1, PTRYI, TRY4, Trygn16, Trypsinogen 1

Entrez Gene IDs

5646 (Human)

Gene Symbol

PRSS3

UniProt

P07477

Additional Trypsin 1/PRSS1 Products

Product Documents for Trypsin 1/PRSS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Trypsin 1/PRSS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Serine Proteases and Regulators

Customer Reviews for Trypsin 1/PRSS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Trypsin 1/PRSS1 Antibody - BSA Free and earn rewards!

Have you used Trypsin 1/PRSS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies