Tryptophan rich protein Antibody (4D6) - Azide and BSA Free

Novus Biologicals | Catalog # H00007485-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4D6

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

WRB (NP_004618, 29 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIK

Specificity

WRB - tryptophan rich basic protein (4D6)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Tryptophan rich protein Antibody (4D6) - Azide and BSA Free

Western Blot: Tryptophan rich protein Antibody (4D6) [H00007485-M05]

Western Blot: Tryptophan rich protein Antibody (4D6) [H00007485-M05]

Western Blot: Tryptophan rich protein Antibody (4D6) [H00007485-M05] - WRB monoclonal antibody (M05), clone 4D6. Western Blot analysis of WRB expression in HeLa ( Cat # L013V1 ).
ELISA: Tryptophan rich protein Antibody (4D6) [H00007485-M05]

ELISA: Tryptophan rich protein Antibody (4D6) [H00007485-M05]

ELISA: Tryptophan rich protein Antibody (4D6) [H00007485-M05] - Detection limit for recombinant GST tagged WRB is approximately 1ng/ml as a capture antibody.

Applications for Tryptophan rich protein Antibody (4D6) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Tryptophan rich protein

This gene encodes a basic nuclear protein of unknown function. The gene is widely expressed in adult and fetal tissues. Since the region proposed to contain the gene(s) for congenital heart disease (CHD) in Down syndrome (DS) patients has been restricted to 21q22.2-22.3, this gene, which maps to 21q22.3, has a potential role in the pathogenesis of Down syndrom congenital heart disease. [provided by RefSeq]

Alternate Names

congenital heart disease 5 protein10tryptophan-rich protein, FLJ51808, tryptophan rich basic protein

Entrez Gene IDs

7485 (Human)

Gene Symbol

GET1

Additional Tryptophan rich protein Products

Product Documents for Tryptophan rich protein Antibody (4D6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tryptophan rich protein Antibody (4D6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tryptophan rich protein Antibody (4D6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Tryptophan rich protein Antibody (4D6) - Azide and BSA Free and earn rewards!

Have you used Tryptophan rich protein Antibody (4D6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...