TSGA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89839

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Predicted:

Rat (90%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TSGA2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30896965).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TSGA2 Antibody - BSA Free

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human cerebral cortex, fallopian tube, placenta and testis using Anti-RSPH1 antibody NBP1-89839 (A) shows similar protein distribution across tissues to independent antibody NBP1-89840 (B).
TSGA2 Antibody - BSA Free Immunohistochemistry-Paraffin: TSGA2 Antibody - BSA Free [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody - BSA Free [NBP1-89839]

Analysis in human fallopian tube and cerebral cortex tissues using NBP1-89839 antibody. Corresponding RSPH1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human placenta shows no positivity in trophoblastic cells as expected.
Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839]

Immunohistochemistry-Paraffin: TSGA2 Antibody [NBP1-89839] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Applications for TSGA2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

Reported in scientific literature (PMID: 30896965)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSGA2

TSGA2 may play an important role in male meiosis

Alternate Names

Cancer/testis antigen 79, CT79, FLJ32753, h-meichroacidin, Male meiotic metaphase chromosome-associated acidic protein, Meichroacidin, radial spoke head 1 homolog, radial spoke head 1 homolog (Chlamydomonas), RSP44, RSPH10A, testes specific A2 homolog, testes specific gene A2 homolog, testis specific A2 homolog, testis specific A2 homolog (mouse), Testis-specific gene A2 protein, TSA2MGC126568, TSGA2MGC141927

Gene Symbol

RSPH1

Additional TSGA2 Products

Product Documents for TSGA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TSGA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TSGA2 Antibody - BSA Free

Customer Reviews for TSGA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSGA2 Antibody - BSA Free and earn rewards!

Have you used TSGA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies