TSLPR, also known as Delta and CRLM-2, is expressed on regulatory T cells (Treg), some subsets of helper T cells, innate lymphoid cells (ILC), monocytes, and dendritic cells. It associates with IL-7R alpha to form a high affinity receptor complex for epithelium-derived TSLP (thymic stromal lymphopoeitin). TSLP is a homeostatic cytokine that induces the release of T cell-attracting chemokines and enhances the maturation of CD1c+ dendritic cells.
New
TSLPR/CRLF2 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP3-25208PEP
Loading...
Loading...
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TSLPR/CRLF2
Source: E.coli
Amino Acid Sequence: YRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Purity
>80% by SDS-PAGE and Coomassie blue staining
Applications
Antibody Competition (10-100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25208It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation, and Storage
NBP3-25208PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: TSLPR
Long Name
Thymic Stromal Lymphopoietin Receptor
Alternate Names
CRL2, CRLF2, CRLM-2, PCOR1, TSLP R
Gene Symbol
CRLF2
Additional TSLPR Products
Product Documents for TSLPR/CRLF2 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TSLPR/CRLF2 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Customer Reviews for TSLPR/CRLF2 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review TSLPR/CRLF2 Recombinant Protein Antigen and earn rewards!
Have you used TSLPR/CRLF2 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Loading...
Associated Pathways
Th2 Differentiation Pathway
