TSPAN15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17323

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TSPAN15 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN

Reactivity Notes

Rat (84%), Rat (81%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TSPAN15 Antibody - BSA Free

Western Blot: TSPAN15 Antibody [NBP3-17323]

Western Blot: TSPAN15 Antibody [NBP3-17323]

Western Blot: TSPAN15 Antibody [NBP3-17323] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunocytochemistry/ Immunofluorescence: TSPAN15 Antibody [NBP3-17323]

Immunocytochemistry/ Immunofluorescence: TSPAN15 Antibody [NBP3-17323]

Immunocytochemistry/Immunofluorescence: TSPAN15 Antibody [NBP3-17323] - Staining of human cell line EFO-21 shows localization to nuclear bodies, cytosol, cell junctions & vesicles.

Applications for TSPAN15 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN15

TSPAN15 is encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.

Long Name

Tetraspanin 15

Alternate Names

NET7, TM4SF15

Gene Symbol

TSPAN15

Additional TSPAN15 Products

Product Documents for TSPAN15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TSPAN15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Integrins and Associated Molecules

Customer Reviews for TSPAN15 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSPAN15 Antibody - BSA Free and earn rewards!

Have you used TSPAN15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies