TSPAN3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62310

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TSPAN3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TSPAN3(tetraspanin 3) The peptide sequence was selected from the middle region of TSPAN3. Peptide sequence SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TSPAN3 Antibody - BSA Free

Western Blot: TSPAN3 Antibody [NBP1-62310]

Western Blot: TSPAN3 Antibody [NBP1-62310]

Western Blot: Tetraspanin-3 Antibody [NBP1-62310] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: TSPAN3 Antibody [NBP1-62310]

Western Blot: TSPAN3 Antibody [NBP1-62310]

Western Blot: Tetraspanin-3 Antibody [NBP1-62310] - Expressed in E. coli, concentration 1 ug/ml.

Applications for TSPAN3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN3

TSPAN3 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. Two alternative transcripts encoding different isoforms have been described.

Long Name

Tetraspanin 3

Alternate Names

TM4A, TM4SF8

Gene Symbol

TSPAN3

UniProt

O60637 (Human)

Additional TSPAN3 Products

Product Documents for TSPAN3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TSPAN3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Integrins and Associated Molecules

Customer Reviews for TSPAN3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSPAN3 Antibody - BSA Free and earn rewards!

Have you used TSPAN3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies