TSPAN32/TSSC6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62646

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TSPAN32/TSSC6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TSPAN32(tetraspanin 32) The peptide sequence was selected from the middle region of TSPAN32. Peptide sequence YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TSPAN32/TSSC6 Antibody - BSA Free

Western Blot: TSPAN32/TSSC6 Antibody [NBP1-62646]

Western Blot: TSPAN32/TSSC6 Antibody [NBP1-62646]

Western Blot: TSPAN32/TSSC6 Antibody [NBP1-62646] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
Immunohistochemistry-Paraffin: TSPAN32/TSSC6 Antibody [NBP1-62646]

Immunohistochemistry-Paraffin: TSPAN32/TSSC6 Antibody [NBP1-62646]

Immunohistochemistry-Paraffin: TSPAN32/TSSC6 Antibody [NBP1-62646] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Applications for TSPAN32/TSSC6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN32/TSSC6

This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as hematopoietic cell function. This gene is described as a member of the tetraspanin superfamily.This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is located among several imprinted genes; however, this gene, as well as the tumor-suppressing subchromosomal transferable fragment 4 (TSSC4), escapes imprinting. This gene may play a role in malignancies and disease that involve this region as well as hematopoietic cell function. This gene is described as a member of the tetraspanin superfamily. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.

Long Name

Tetraspanin 32

Alternate Names

ART1, PHEMX, PHMX, TSSC6

Gene Symbol

TSPAN32

UniProt

Q96QS1-2 (Human)

Additional TSPAN32/TSSC6 Products

Product Documents for TSPAN32/TSSC6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TSPAN32/TSSC6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TSPAN32/TSSC6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSPAN32/TSSC6 Antibody - BSA Free and earn rewards!

Have you used TSPAN32/TSSC6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies