TST Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54682

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TST Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to TST(thiosulfate sulfurtransferase (rhodanese)) The peptide sequence was selected from the middle region of TST. Peptide sequence GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TST Antibody - BSA Free

Western Blot: TST Antibody [NBP1-54682]

Western Blot: TST Antibody [NBP1-54682]

Western Blot: TST Antibody [NBP1-54682] - Jurkat cell lysate, concentration 1 ug/ml.
Immunohistochemistry: TST Antibody [NBP1-54682]

Immunohistochemistry: TST Antibody [NBP1-54682]

Immunohistochemistry: TST Antibody [NBP1-54682] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: TST Antibody [NBP1-54682]

Immunohistochemistry-Paraffin: TST Antibody [NBP1-54682]

Immunohistochemistry-Paraffin: TST Antibody [NBP1-54682] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
Immunohistochemistry: TST Antibody [NBP1-54682]

Immunohistochemistry: TST Antibody [NBP1-54682]

Immunohistochemistry: TST Antibody [NBP1-54682] - Analysis of human small intestine after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.

Applications for TST Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TST

TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Alternate Names

EC 2.8.1, EC 2.8.1.1, MGC19578, RDSRhodanese, thiosulfate sulfurtransferase, thiosulfate sulfurtransferase (rhodanese)

Gene Symbol

TST

UniProt

Q16762 (Human)

Additional TST Products

Product Documents for TST Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TST Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TST Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TST Antibody - BSA Free and earn rewards!

Have you used TST Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies