Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03879

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 280-370 of human Tyrosylprotein Sulfotransferase 2/TPST2 (NP_003586.3). SKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free

Western Blot: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free [Tyrosylprotein Sulfotransferase 2/TPST2] -

Western Blot: Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - Azide and BSA Free [Tyrosylprotein Sulfotransferase 2/TPST2] - Western blot analysis of lysates from U-2 OS cells using Tyrosylprotein Sulfotransferase 2/TPST2 Rabbit pAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit
Exposure time: 60s.

Applications for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Tyrosylprotein Sulfotransferase 2/TPST2

The protein encoded by the TPST2 gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 both encode the same protein.

Alternate Names

Tyrosylprotein Sulfotransferase 2

Gene Symbol

TPST2

Additional Tyrosylprotein Sulfotransferase 2/TPST2 Products

Product Documents for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free and earn rewards!

Have you used Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Tyrosylprotein Sulfotransferase 2/TPST2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: What is the lower limit of detection for TPST2 in Western blot?

    A: We generally do not test the limits of detection for our antibodies as this time. I apologize for the inconvenience.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...