Ubiquitin B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54736

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Ubiquitin+1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a Recombinant Protein corresponding to amino acids: GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Ubiquitin B Antibody - BSA Free

Western Blot: Ubiquitin B Antibody [NBP2-54736]

Western Blot: Ubiquitin B Antibody [NBP2-54736]

Western Blot: Ubiquitin Antibody [NBP2-54736] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue
Immunohistochemistry-Paraffin: Ubiquitin B Antibody [NBP2-54736]

Immunohistochemistry-Paraffin: Ubiquitin B Antibody [NBP2-54736]

Immunohistochemistry-Paraffin: Ubiquitin Antibody [NBP2-54736] - Staining of human urinary bladder shows nuclear and cytoplasmic positivity in urothelial cells.

Applications for Ubiquitin B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ubiquitin+1

ubiquitin B encodes ubiquitin, one of the most conserved proteins known. Ubiquitin is required for ATP-dependent, nonlysosomal intracellular protein degradation of abnormal proteins and normal proteins with a rapid turnover. Ubiquitin is covalently bound to proteins to be degraded, and presumably labels these proteins for degradation. Ubiquitin also binds to histone H2A in actively transcribed regions but does not cause histone H2A degradation, suggesting that ubiquitin is also involved in regulation of gene expression. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. Aberrant form of this protein has been noticed in patients with Alzheimer's and Down syndrome.

Long Name

frame shift mutant

Alternate Names

FLJ25987, MGC8385, polyubiquitin B, polyubiquitin-B, RPS27A, UBA52, UBC, ubiquitin B

Gene Symbol

UBB

Additional Ubiquitin+1 Products

Product Documents for Ubiquitin B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Ubiquitin B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

NFkB Pathway

Customer Reviews for Ubiquitin B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ubiquitin B Antibody - BSA Free and earn rewards!

Have you used Ubiquitin B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies