UCP3 Antibody (10I0J9)

Novus Biologicals | Catalog # NBP3-33419

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 10I0J9
View all UCP3 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human UCP3 (NP_003347.1).

Sequence:
YDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for UCP3 Antibody (10I0J9)

UCP3 Antibody (10I0J9)

Western Blot: UCP3 Antibody (10I0J9) [NBP3-33419] -

Western Blot: UCP3 Antibody (10I0J9) [NBP3-33419] - Western blot analysis of lysates from Mouse skeletal muscle, using UCP3 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.

Applications for UCP3 Antibody (10I0J9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UCP3

The uncoupling proteins (UCPs) are found in the inner mitochondrial membranes and belong to a family of mitochondrial anion transport proteins that include the phosphate and oxologutarate carriers and the ADP/ATP translocator. Three UCP subtypes have been identified and cloned. UCP 1 is abundantly expressed in brown adipose tissue of mammals. UCP 1 allows proton re-entry into the mitochondrial matrix without involving the F0-F1 ATPase which produces heat instead of ATP. It is thought that UCP 2 and 3 also dissipate the mitochondrial proton gradient produced by the respiratory chain in cells and tissues within which they are expressed. Studies have shown UCP 2 to be expressed by a variety of tissues. UCP 3 is expressed predominantly in brown adipose tissue, skeletal muscle, at lower levels in heart and smooth muscle, and is absent in liver and kidney.

Long Name

Uncoupling Protein 3 (Mitochondrial, Proton Carrier)

Alternate Names

SLC25A9

Gene Symbol

UCP3

Additional UCP3 Products

Product Documents for UCP3 Antibody (10I0J9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UCP3 Antibody (10I0J9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UCP3 Antibody (10I0J9)

There are currently no reviews for this product. Be the first to review UCP3 Antibody (10I0J9) and earn rewards!

Have you used UCP3 Antibody (10I0J9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies