UCP5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59598

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Western Blot

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UCP5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC25A14(solute carrier family 25 (mitochondrial carrier, brain), member 14) The peptide sequence was selected from the N terminal of SLC25A14 (CAI42439). Peptide sequence SIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGV The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:31907603).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UCP5 Antibody - BSA Free

Western Blot: UCP5 Antibody [NBP1-59598]

Western Blot: UCP5 Antibody [NBP1-59598]

Western Blot: UCP5 Antibody [NBP1-59598] - Jurkat cell lysate, concentration 2.5 ug/ml.

Applications for UCP5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

Reported in scientific literature (PMID: 31907603)

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UCP5

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. SLC25A14 has an N-terminal hydrophobic domain that is not present in other UCPs.

Alternate Names

BMCP-1, BMCP1UCP 5, brain mitochondrial carrier protein 1, Mitochondrial uncoupling protein 5, solute carrier family 25 (mitochondrial carrier, brain), member 14, Solute carrier family 25 member 14, UCP5MGC149543

Entrez Gene IDs

9016 (Human)

Gene Symbol

SLC25A14

UniProt

Q5JY88 (Human)

Additional UCP5 Products

Product Documents for UCP5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UCP5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for UCP5 Antibody - BSA Free

Customer Reviews for UCP5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UCP5 Antibody - BSA Free and earn rewards!

Have you used UCP5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies