UHRF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13504

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: VFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UHRF1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: UHRF1 Antibody [NBP2-13504]

Immunocytochemistry/ Immunofluorescence: UHRF1 Antibody [NBP2-13504]

Immunocytochemistry/Immunofluorescence: UHRF1 Antibody [NBP2-13504] Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504]

Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504]

Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504] - Staining of human liver
Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504]

Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504]

Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504] - Staining of human cerebral cortex, liver, lymph node and thymus using Anti-UHRF1 antibody NBP2-13504 (A) shows similar protein distribution across tissues to independent antibody NBP2-68720 (B).
Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504]

Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504]

Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504] - Staining of human thymus.
Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504]

Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504]

Immunohistochemistry-Paraffin: UHRF1 Antibody [NBP2-13504] - Staining of human cerebral cortex.
UHRF1 Antibody - BSA Free Immunohistochemistry: UHRF1 Antibody - BSA Free [NBP2-13504]

Immunohistochemistry: UHRF1 Antibody - BSA Free [NBP2-13504]

Staining of human lymph node using Anti-UHRF1 antibody NBP2-13504.

Applications for UHRF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UHRF1

UHRF1 encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.

Long Name

E3 ubiquitin-protein ligase UHRF1

Alternate Names

hNp95, hUHRF1, HuNp95, ICBP90, NP95, Nuclear protein 95, RNF106

Gene Symbol

UHRF1

Additional UHRF1 Products

Product Documents for UHRF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UHRF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UHRF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UHRF1 Antibody - BSA Free and earn rewards!

Have you used UHRF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...