UNC45A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13506

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UNC45A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UNC45A Antibody - BSA Free

Western Blot: UNC45A Antibody [NBP2-13506]

Western Blot: UNC45A Antibody [NBP2-13506]

Western Blot: UNC45A Antibody [NBP2-13506] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: UNC45A Antibody [NBP2-13506]

Immunocytochemistry/ Immunofluorescence: UNC45A Antibody [NBP2-13506]

Immunocytochemistry/Immunofluorescence: UNC45A Antibody [NBP2-13506] - Staining of human cell line HEK 293 shows positivity in cytoplasm and golgi apparatus.
Immunohistochemistry-Paraffin: UNC45A Antibody [NBP2-13506]

Immunohistochemistry-Paraffin: UNC45A Antibody [NBP2-13506]

Immunohistochemistry-Paraffin: UNC45A Antibody [NBP2-13506] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: UNC45A Antibody [NBP2-13506]

Immunohistochemistry-Paraffin: UNC45A Antibody [NBP2-13506]

Immunohistochemistry-Paraffin: UNC45A Antibody [NBP2-13506] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
UNC45A Antibody - BSA Free Immunohistochemistry: UNC45A Antibody - BSA Free [NBP2-13506]

Immunohistochemistry: UNC45A Antibody - BSA Free [NBP2-13506]

Staining of human Small intestine shows strong cytoplasmic positivity in glandular cells.
UNC45A Antibody - BSA Free Western Blot: UNC45A Antibody - BSA Free [NBP2-13506]

Western Blot: UNC45A Antibody - BSA Free [NBP2-13506]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
UNC45A Antibody - BSA Free Immunohistochemistry: UNC45A Antibody - BSA Free [NBP2-13506]

Immunohistochemistry: UNC45A Antibody - BSA Free [NBP2-13506]

Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.
UNC45A Antibody - BSA Free Immunohistochemistry: UNC45A Antibody - BSA Free [NBP2-13506]

Immunohistochemistry: UNC45A Antibody - BSA Free [NBP2-13506]

Staining of human Skin shows strong cytoplasmic positivity in squamous epithelial cells.
UNC45A Antibody - BSA Free Immunohistochemistry: UNC45A Antibody - BSA Free [NBP2-13506]

Immunohistochemistry: UNC45A Antibody - BSA Free [NBP2-13506]

Staining of human Testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Applications for UNC45A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UNC45A

UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor (PGR; MIM 607311) and HSP90 (HSPCA; MIM 140571), and acts as a regulator of the progesterone receptor chaperoning pathway (Price et al., 2002 [PubMed 12356907]; Chadli et al., 2006 [PubMed 16478993]).[supplied by OMIM]

Alternate Names

FLJ10043, GCUNC45, GC-UNC45, GCUNC-45, general cell UNC45, protein unc-45 homolog A, SMAP-1IRO039700, SMAP1UNC-45A, smooth muscle cell associated protein-1, Smooth muscle cell-associated protein 1, unc-45 homolog A (C. elegans), Unc-45A

Gene Symbol

UNC45A

Additional UNC45A Products

Product Documents for UNC45A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UNC45A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UNC45A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UNC45A Antibody - BSA Free and earn rewards!

Have you used UNC45A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies