Uroplakin Ib Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80656

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Uroplakin Ib Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR

Reactivity Notes

Mouse reactivity reported from a verified customer review. Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Uroplakin Ib Antibody - BSA Free

Western Blot: Uroplakin Ib Antibody [NBP1-80656]

Western Blot: Uroplakin Ib Antibody [NBP1-80656]

Western Blot: Uroplakin Ib Antibody [NBP1-80656] - Analysis of Uroplakin Ib antibody. Lane M: Protein marker Lane 1: UMUC1 cell lysates 30 ug Lane 2: RT112 cell lysates 30 ug. Image from verified customer review.
Uroplakin Ib Antibody - BSA Free

Uroplakin Ib Antibody [NBP1-80656] -

Staining of human urinary bladder shows strong membranous positivity in urothelial cells.
Western Blot: Uroplakin Ib Antibody [NBP1-80656]

Western Blot: Uroplakin Ib Antibody [NBP1-80656]

Western Blot: Uroplakin Ib Antibody [NBP1-80656] - Analysis in control (3.1 kDa) in mammalian HEK293T cells).
Uroplakin Ib Antibody - BSA Free

Uroplakin Ib Antibody [NBP1-80656] -

Staining of human stomach shows moderate membranous positivity in glandular cells.
Uroplakin Ib Antibody - BSA Free

Uroplakin Ib Antibody [NBP1-80656] -

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Uroplakin Ib Antibody - BSA Free

Uroplakin Ib Antibody [NBP1-80656] -

Staining of human prostate shows no positivity in glandular cells as expected.

Applications for Uroplakin Ib Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 2 reviews rated 5 using NBP1-80656 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Uroplakin Ib

UPK1B - uroplakin 1B

Alternate Names

TSPAN20, UP1b, UPIB, UPK1B, Uroplakin 1B

Entrez Gene IDs

7348 (Human)

Gene Symbol

UPK1B

Additional Uroplakin Ib Products

Product Documents for Uroplakin Ib Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Uroplakin Ib Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Integrins and Associated Molecules

Citations for Uroplakin Ib Antibody - BSA Free

Customer Reviews for Uroplakin Ib Antibody - BSA Free (2)

5 out of 5
2 Customer Ratings
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Uroplakin Ib Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • Uroplakin Ib Antibody
    Name: Ming Lu
    Application: Western Blot
    Sample Tested: Bladder cancer cell line lysate
    Species: Human
    Verified Customer | Posted 01/20/2023
    Exposure time is 5 min. Background is clean.
    Uroplakin Ib Antibody - BSA Free NBP1-80656
  • Uroplakin Ib Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Bladder tissue
    Species: Mouse
    Verified Customer | Posted 01/17/2020
    UPK 1b positive staining (brown) of murine bladder epithelium.
    4% paraformaldehyde fixation, paraffin embedding, and pH 6 HEIR retrieval method and DAB kit used.
    Uroplakin Ib Antibody - BSA Free NBP1-80656

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies