USP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85950

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGKITTNQGVKGQSKENECDP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for USP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950]

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950]

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Analysis in human testis and pancreas tissues using NBP1-85950 antibody. Corresponding USP1 RNA-seq data are presented for the same tissues.
Western Blot: USP1 Antibody [NBP1-85950]

Western Blot: USP1 Antibody [NBP1-85950]

Western Blot: USP1 Antibody [NBP1-85950] - Analysis using Anti-USP1 antibody NBP1-85950 (A) shows similar pattern to independent antibody NBP2-55036 (B).
Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950]

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950]

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950]

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950]

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Staining of human testis shows moderate nuclear positivity in cells in seminiferious ducts.
Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950]

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950]

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950]

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950]

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.

Applications for USP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: USP1

USP1 encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. The protein specifically deubiquitinates a protein in the Fanconi anemia (FA) DNA repair pathway. Alternate transcriptional splice variants have been characterized. [provided by RefSeq]

Long Name

Ubiquitin Specific Protease 1

Alternate Names

Deubiquitinating Enzyme 1, Ubiquitin Carboxyl-Terminal Hydrolase 1, Ubiquitin Thioesterase 1, UBP

Gene Symbol

USP1

Additional USP1 Products

Product Documents for USP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for USP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for USP1 Antibody - BSA Free

Customer Reviews for USP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review USP1 Antibody - BSA Free and earn rewards!

Have you used USP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...