UTP20 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58128

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UTP20 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC

Reactivity Notes

Mouse 81%, Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UTP20 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: UTP20 Antibody [NBP2-58128]

Immunocytochemistry/ Immunofluorescence: UTP20 Antibody [NBP2-58128]

Immunocytochemistry/Immunofluorescence: UTP20 Antibody [NBP2-58128] - Staining of human cell line SiHa shows localization to nucleoli & plasma membrane.

Applications for UTP20 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UTP20

Using the differential display technique, DRIM (down-regulated in metastasis protein) was first identified as a gene down-regulated in metastasis. Later studies found that it is a homolog of the yeast Utp20 protein and associates with U3 snoRNA to function in the processing of 18S rRNA. Alternate names for DRIM include 1A6, protein key-1A6, novel nucleolar protein 73, and NNP73.

Alternate Names

Down-regulated in metastasis protein, DRIMdown regulated in metastasis, NNP73, Novel nucleolar protein 73, Protein Key-1A6, small subunit processome component 20 homolog, UTP20, small subunit (SSU) processome component, homolog (yeast)

Gene Symbol

UTP20

Additional UTP20 Products

Product Documents for UTP20 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UTP20 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UTP20 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UTP20 Antibody - BSA Free and earn rewards!

Have you used UTP20 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies