VAC14 Antibody (3B2) - Azide and BSA Free

Novus Biologicals | Catalog # H00055697-M03

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3B2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

VAC14 (NP_060522.3, 714 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL

Specificity

Reacts with Vac14 homolog (S. cerevisiae).

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for VAC14 Antibody (3B2) - Azide and BSA Free

Western Blot: VAC14 Antibody (3B2) [H00055697-M03]

Western Blot: VAC14 Antibody (3B2) [H00055697-M03]

Western Blot: VAC14 Antibody (3B2) [H00055697-M03] - Analysis of VAC14 expression in transfected 293T cell line by VAC14 monoclonal antibody (M03), clone 3B2. Lane 1: VAC14 transfected lysate (Predicted MW: 88 KDa). Lane 2: Non-transfected lysate.
Sandwich ELISA: VAC14 Antibody (3B2) [H00055697-M03] - Detection limit for recombinant GST tagged VAC14 is 0.1 ng/ml as a capture antibody.

Applications for VAC14 Antibody (3B2) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: VAC14

Phosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) is a low-abundance signaling molecule. A regulatory complex made up of VAC14 and FIG4 (MIM 609390) control synthesis of PI(3,5)P2 by activating PI(3)P kinase, FAB1 (PIP5K3; MIM 609414). The VAC14/FIG4 complex also functions in the breakdown of PI(3,5)P2 (Zhang et al., 2007 [PubMed 17956977]).[supplied by OMIM]

Alternate Names

ArPIKfyve, FLJ10305, FLJ36622, MGC149816, protein VAC14 homolog, Tax1 (human T-cell leukemia virus type I) binding protein 1, Tax1 (human T-cell leukemia virus type I) binding protein 2, Tax1-binding protein 2, TAX1BP2FLJ46582, TRXMGC149815, Vac14 homolog (S. cerevisiae)

Entrez Gene IDs

55697 (Human)

Gene Symbol

VAC14

Additional VAC14 Products

Product Documents for VAC14 Antibody (3B2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VAC14 Antibody (3B2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VAC14 Antibody (3B2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review VAC14 Antibody (3B2) - Azide and BSA Free and earn rewards!

Have you used VAC14 Antibody (3B2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...