VAMP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13512

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all VAMP4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDK

Marker

Vesicle Marker, Golgi Apparatus Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for VAMP4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: VAMP4 Antibody [NBP2-13512]

Immunocytochemistry/ Immunofluorescence: VAMP4 Antibody [NBP2-13512]

Immunocytochemistry/Immunofluorescence: VAMP4 Antibody [NBP2-13512] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512]

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512]

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512]

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512]

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells
Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512]

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512]

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human skeletal muscle shows weak positivity in myocytes.
Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512]

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512]

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding VAMP4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512]

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512]

Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.
VAMP4 Antibody - BSA Free Immunohistochemistry: VAMP4 Antibody - BSA Free [NBP2-13512]

Immunohistochemistry: VAMP4 Antibody - BSA Free [NBP2-13512]

Staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells.
VAMP4 Antibody - BSA Free Immunohistochemistry: VAMP4 Antibody - BSA Free [NBP2-13512]

Immunohistochemistry: VAMP4 Antibody - BSA Free [NBP2-13512]

Analysis in human cerebral cortex and skeletal muscle tissues using NBP2-13512 antibody. Corresponding VAMP4 RNA-seq data are presented for the same tissues.

Applications for VAMP4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VAMP4

The vesicle associated membrane proteins (VAMP) or synaptobrevins are calcium binding proteins specific to eukaryotes. VAMPs, along with synaptosomal associated protein of 25 kDa (SNAP 25) and syntaxin, form the core complex of soluble NSF attachment protein receptor (SNARE) proteins that interact with the soluble proteins N-ethylmaleimide-sensitive factor (NSF) and alpha-SNAP. These membrane associated proteins play a key role in the regulation of vesicle membrane fusion with the plasma membrane. The Clostridium tetani neurotoxin is a metalloprotease with specificity for VAMP. In Alzheimer®s disease, VAMP levels of all isoforms appear to be significantly lowered.

Alternate Names

VAMP24, VAMP-4, vesicle-associated membrane protein 4

Gene Symbol

VAMP4

Additional VAMP4 Products

Product Documents for VAMP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for VAMP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for VAMP4 Antibody - BSA Free

Customer Reviews for VAMP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VAMP4 Antibody - BSA Free and earn rewards!

Have you used VAMP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies