Vanilloid R-like 3/TRPV3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57314

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Vanilloid R-like 3/TRPV3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETS

Reactivity Notes

Mouse 89%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Vanilloid R-like 3/TRPV3 Antibody - BSA Free (NBP2-57314) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Vanilloid R-like 3/TRPV3 Antibody [NBP2-57314]

Immunocytochemistry/ Immunofluorescence: Vanilloid R-like 3/TRPV3 Antibody [NBP2-57314]

Immunocytochemistry/Immunofluorescence: Vanilloid R-like 3/TRPV3 Antibody [NBP2-57314] - Staining of human cell line CACO-2 shows localization to plasma membrane.

Applications for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Vanilloid R-like 3/TRPV3

Transient receptor potential (TRP) proteins are cation selective channels that function in processes as diverse as sensation and vasoregulation. TRPV3 is a receptor activated non selective calcium permeant cation channel that is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. TRPV3 is expressed in skin, tongue, dorsal root ganglion, trigeminal ganglion, spinal cord and brain and is thermosensitive in the physiological range of temperatures between TRPM8 and TRPV1.

Long Name

Vanilloid Receptor Like 3/Transient Receptor Potential Cation Channel 3

Alternate Names

TRPV3, VanilloidR like 3, VanilloidR-like3, VRL3

Gene Symbol

TRPV3

Additional Vanilloid R-like 3/TRPV3 Products

Product Documents for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Vanilloid R-like 3/TRPV3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Vanilloid R-like 3/TRPV3 Antibody - BSA Free and earn rewards!

Have you used Vanilloid R-like 3/TRPV3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies