VMAT1/SLC18A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88577

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all VMAT1/SLC18A1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human VMAT1/SLC18A1. Peptide sequence: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for VMAT1/SLC18A1 Antibody - BSA Free

Western Blot: VMAT1/SLC18A1 Antibody [NBP2-88577]

Western Blot: VMAT1/SLC18A1 Antibody [NBP2-88577]

Western Blot: VMAT1/SLC18A1 Antibody [NBP2-88577] - WB Suggested Anti-SLC18A1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 293T cell lysate
Immunohistochemistry: VMAT1/SLC18A1 Antibody [NBP2-88577]

Immunohistochemistry: VMAT1/SLC18A1 Antibody [NBP2-88577]

Immunohistochemistry: VMAT1/SLC18A1 Antibody [NBP2-88577] - Brain, cortex
Western Blot: VMAT1/SLC18A1 Antibody [NBP2-88577]

Western Blot: VMAT1/SLC18A1 Antibody [NBP2-88577]

Western Blot: VMAT1/SLC18A1 Antibody [NBP2-88577] - Host: Rabbit. Target Name: SLC18A1. Sample Tissue: Human PANC1 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry: VMAT1/SLC18A1 Antibody [NBP2-88577]

Immunohistochemistry: VMAT1/SLC18A1 Antibody [NBP2-88577]

Immunohistochemistry: VMAT1/SLC18A1 Antibody [NBP2-88577] - Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5ug/ml using anti-SLC18A1 antibody

Applications for VMAT1/SLC18A1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VMAT1/SLC18A1

The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (Peter et al., 1993 [PubMed 7905859]). See also SLC18A2 (MIM 193001).[supplied by OMIM]

Long Name

Vesicular Monoamine Transporter 1/Solute Carrier Family 18, Member 1

Alternate Names

CGAT, SLC18A1, VAT1

Gene Symbol

SLC18A1

Additional VMAT1/SLC18A1 Products

Product Documents for VMAT1/SLC18A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VMAT1/SLC18A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for VMAT1/SLC18A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VMAT1/SLC18A1 Antibody - BSA Free and earn rewards!

Have you used VMAT1/SLC18A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies