WDR44 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56672

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WDR44 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VIGTYDGRCIFYDTEHLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKYKG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WDR44 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: WDR44 Antibody [NBP2-56672]

Immunocytochemistry/ Immunofluorescence: WDR44 Antibody [NBP2-56672]

Immunocytochemistry/Immunofluorescence: WDR44 Antibody [NBP2-56672] - Staining of human cell line A-431 shows localization to the Golgi apparatus.

Applications for WDR44 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDR44

WDR44 is a member of the WD repeat family. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. WD-repeat domain 44 (WDR44) was originally identified as rabphilin-11, a protein isolated from bovine brain extracts and cloned from a rat brain cDNA library. Rabphilin-11 was found to bind GTP-Rab11 and proposed to localize to the Golgi and recycling endosomes suggesting a role in vesicle recycling. WDR44 contains seven WD (tryptophan-aspartate) repeat domains found in a number of proteins that function as adaptor molecules in signal transduction and cytoskeletal organization.

Alternate Names

DKFZp686L20145, FLJ13230, MGC26781, RAB11BP, Rabphilin-11, RPH11, WD repeat domain 44, WD repeat-containing protein 44

Gene Symbol

WDR44

Additional WDR44 Products

Product Documents for WDR44 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WDR44 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDR44 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WDR44 Antibody - BSA Free and earn rewards!

Have you used WDR44 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies