WDR46 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25230

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WDR46 Primary Antibodies »

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein WDR46 using the following amino acid sequence: LSTRTLPHGAGHLAFSQRGLLVAGMGDVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WDR46 Antibody - BSA Free

WDR46 Antibody Immunocytochemistry/Immunofluorescence: WDR46 Antibody [NBP3-25230]

Immunocytochemistry/Immunofluorescence: WDR46 Antibody [NBP3-25230]

Staining of human cell line MCF-7 shows localization to nucleoli.

Applications for WDR46 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WDR46

WDR46 was originally identified as BING-4, a protein encoded in a gene-rich region of the major histocompatibility complex (MHC). WDR46 has been found to be overexpressed in a subset of melanoma cell lines and is a cancer antigen recognized by lymphocytes. WDR46 bears six WD repeats. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. WD proteins are involved in a variety of cellular processes. The function of WDR46 has not been characterized.

Alternate Names

BING4FP221, C6orf11, chromosome 6 open reading frame 11, WD repeat domain 46, WD repeat-containing protein 46, WD repeat-containing protein BING4

Gene Symbol

WDR46

Additional WDR46 Products

Product Documents for WDR46 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WDR46 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDR46 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WDR46 Antibody - BSA Free and earn rewards!

Have you used WDR46 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies