WDR68 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-95210

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human DCAF7 (NP_005819.3). MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WDR68 Antibody - Azide and BSA Free

Western Blot: WDR68 AntibodyAzide and BSA Free [NBP2-95210]

Western Blot: WDR68 AntibodyAzide and BSA Free [NBP2-95210]

Western Blot: WDR68 Antibody [NBP2-95210] - Western blot analysis of extracts of various cell lines, using WDR68 antibody (NBP2-95210) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunocytochemistry/Immunofluorescence: WDR68 Antibody [NBP2-95210] - Immunofluorescence analysis of U2OS cells using WDR68 Rabbit pAb (NBP2-95210) at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunohistochemistry-Paraffin: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunohistochemistry-Paraffin: WDR68 Antibody [NBP2-95210] - Immunohistochemistry of paraffin-embedded rat stomach using WDR68 Rabbit pAb (NBP2-95210) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunocytochemistry/Immunofluorescence: WDR68 Antibody [NBP2-95210] - Immunofluorescence analysis of NIH/3T3 cells using WDR68 Rabbit pAb (NBP2-95210) at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunocytochemistry/Immunofluorescence: WDR68 Antibody [NBP2-95210] - Immunofluorescence analysis of PC-12 cells using WDR68 Rabbit pAb (NBP2-95210) at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunohistochemistry-Paraffin: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunohistochemistry-Paraffin: WDR68 Antibody [NBP2-95210] - Immunohistochemistry of paraffin-embedded human lung cancer using WDR68 Rabbit pAb (NBP2-95210) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunohistochemistry-Paraffin: WDR68 Antibody - Azide and BSA Free [NBP2-95210]

Immunohistochemistry-Paraffin: WDR68 Antibody [NBP2-95210] - Immunohistochemistry of paraffin-embedded mouse stomach using WDR68 Rabbit pAb (NBP2-95210) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
WDR68 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [WDR68] -

Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [WDR68] - Immunofluorescence analysis of PC-12 cells using WDR68 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
WDR68 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [WDR68] -

Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [WDR68] - Immunofluorescence analysis of NIH/3T3 cells using WDR68 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
WDR68 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [WDR68] -

Immunocytochemistry/ Immunofluorescence: WDR68 Antibody - Azide and BSA Free [WDR68] - Immunofluorescence analysis of U2OS cells using WDR68 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for WDR68 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: WDR68

WDR68 is involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of theupper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the firstand second arches. Associates w

Alternate Names

DDB1 and CUL4 associated factor 7, DDB1- and CUL4-associated factor 7, HAN11AN11, human anthocyanin, seven-WD-repeat protein of the AN11 family-1, SWAN-1, WD repeat domain 68, WD repeat-containing protein 68, WD repeat-containing protein An11 homolog, WDR68, WD-repeat protein

Gene Symbol

DCAF7

Additional WDR68 Products

Product Documents for WDR68 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WDR68 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WDR68 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review WDR68 Antibody - Azide and BSA Free and earn rewards!

Have you used WDR68 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...