WHSC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55447

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all WHSC2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTET

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WHSC2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: WHSC2 Antibody [NBP2-55447]

Immunocytochemistry/ Immunofluorescence: WHSC2 Antibody [NBP2-55447]

Immunocytochemistry/Immunofluorescence: WHSC2 Antibody [NBP2-55447] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
WHSC2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: WHSC2 Antibody - BSA Free [NBP2-55447]

Chromatin Immunoprecipitation-exo-Seq: WHSC2 Antibody - BSA Free [NBP2-55447]

ChIP-Exo-Seq composite graph for Anti-NELFA (NBP2-55447) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for WHSC2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WHSC2

WHSC2 is expressed ubiquitously with higher levels in fetal than in adult tissues. It encodes a protein sharing 93% sequence identity with the mouse protein. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene is mapped to the 165 kb WHS critical region, and may play a role in the phenotype of the WHS or Pitt-Rogers-Danks syndrome. The encoded protein is found to be capable of reacting with HLA-A2-restricted and tumor-specific cytotoxic T lymphocytes, suggesting a target for use in specific immunotherapy for a large number of cancer patients. This protein has also been shown to be a member of the NELF (negative elongation factor) protein complex that participates in the regulation of RNA polymerase II transcription elongation. [provided by RefSeq]

Alternate Names

FLJ10442, negative elongation factor A, NELFA, NELF-AFLJ25112, Wolf-Hirschhorn syndrome candidate 2, Wolf-Hirschhorn syndrome candidate 2 protein

Gene Symbol

NELFA

Additional WHSC2 Products

Product Documents for WHSC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for WHSC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WHSC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WHSC2 Antibody - BSA Free and earn rewards!

Have you used WHSC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies