XAB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35227

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 255-374 of human XAB1 (NP_009197.2).

Sequence:
VGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for XAB1 Antibody - BSA Free

XAB1 Antibody

Western Blot: XAB1 Antibody [NBP3-35227] -

Western Blot: XAB1 Antibody [NBP3-35227] - Western blot analysis of various lysates using XAB1 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for XAB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: XAB1

The DNA methylation system is composed of methyl-CpG-binding proteins, as well as of DNA cytosine methyl transferases. Five methyl-CpG binding proteins were isolated: MeCP2, MBD1, MBD2, MBD3 and MBD4. MBD2 consists of two isoforms, MBD2a and MBD2b, which are generated from a single gene. MBD2a is a component of MeCP1, a large corepressor complex that represses transcription from densely methylated genes. Components of MeCP1 include MBD2, Mi-2, MTA2, MBD3 and HDAC1/2. MIZF and MBDin were isolated as proteins interacting with MBD2. MBDin, in turn, is identical to XPA binding protein 1 (XAB1). At the N erminus, the protein contains the consensus sequence for a GTP binding site. At the C terminus, the protein is characterized by an acidic domain containing a cluster of acidic amino acid residues. The transcriptional repression by MBD2 at methylated promoters is relieved by MBdin. XAB1 is expressed ubiquitously, and may be involved in nuclear localization of XPA.

Alternate Names

ATP(GTP)-binding protein, ATPBD1A, GPN-loop GTPase 1, GTPase, MBD2-interacting protein, MBDin, MBDINXPA binding protein 1, XAB1FLJ51176, XPA-binding protein 1

Gene Symbol

GPN1

Additional XAB1 Products

Product Documents for XAB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for XAB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for XAB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review XAB1 Antibody - BSA Free and earn rewards!

Have you used XAB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...