XAGE2 Antibody (4C4) - Azide and BSA Free

Novus Biologicals | Catalog # H00009502-M12

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 4C4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

XAGE2 (NP_570133, 44 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV

Specificity

Reacts with X antigen family, member 2.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for XAGE2 Antibody (4C4) - Azide and BSA Free

Western Blot: XAGE2 Antibody (4C4) [H00009502-M12]

Western Blot: XAGE2 Antibody (4C4) [H00009502-M12]

Western Blot: XAGE2 Antibody (4C4) [H00009502-M12] - Analysis of XAGE2 expression in transfected 293T cell line by XAGE2 monoclonal antibody (M12), clone 4C4. Lane 1: XAGE2 transfected lysate (Predicted MW: 12.4 KDa). Lane 2: Non-transfected lysate.
Sandwich ELISA: XAGE2 Antibody (4C4) [H00009502-M12] - Detection limit for recombinant GST tagged XAGE2 is 0.1 ng/ml as a capture antibody.

Applications for XAGE2 Antibody (4C4) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: XAGE2

This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in normal testis, and in Ewing's sarcoma, rhabdomyosarcoma, a breast cancer and a germ cell tumor. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. [provided by RefSeq]

Alternate Names

Cancer/testis antigen 12.2, cancer/testis antigen family 12, member 2, CT12.2GAGED3, G antigen family D member 3, G antigen, family D, 3, Protein XAGE-2, X antigen family, member 2, XAGE-2, XAGE2B

Entrez Gene IDs

9502 (Human)

Gene Symbol

XAGE2

Additional XAGE2 Products

Product Documents for XAGE2 Antibody (4C4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for XAGE2 Antibody (4C4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for XAGE2 Antibody (4C4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review XAGE2 Antibody (4C4) - Azide and BSA Free and earn rewards!

Have you used XAGE2 Antibody (4C4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...