XK X-linked Kx blood group Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93011

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 59-138 of human XK (NP_066569.1). HRDLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for XK X-linked Kx blood group Antibody - Azide and BSA Free

Western Blot: XK X-linked Kx blood group AntibodyAzide and BSA Free [NBP2-93011]

Western Blot: XK X-linked Kx blood group AntibodyAzide and BSA Free [NBP2-93011]

Western Blot: XK X-linked Kx blood group Antibody [NBP2-93011] - Analysis of extracts of various cell lines, using XK X-linked Kx blood group at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011]

Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011]

Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP2-93011] - Analysis of U-2 OS cells using XK X-linked Kx blood group at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011]

Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011]

Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP2-93011] - Analysis of C6 cells using XK X-linked Kx blood group at dilution of 1:100. Blue: DAPI for nuclear staining.
XK X-linked Kx blood group Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011] -

Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011] - Immunofluorescence analysis of L929 cells using XK X-linked Kx blood group Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for XK X-linked Kx blood group Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: XK X-linked Kx blood group

This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. The encoded protein has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. (provided by RefSeq)

Alternate Names

Kell blood group precursor (McLeod phenotype), Kell complex 37 kDa component, KX, Kx antigen, membrane transport protein XK, X1k, XK, Kell blood group complex subunit (McLeod syndrome), XKR1XK-related protein 1, X-linked Kx blood group (McLeod syndrome), XRG1

Gene Symbol

XK

Additional XK X-linked Kx blood group Products

Product Documents for XK X-linked Kx blood group Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for XK X-linked Kx blood group Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for XK X-linked Kx blood group Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review XK X-linked Kx blood group Antibody - Azide and BSA Free and earn rewards!

Have you used XK X-linked Kx blood group Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...