XRCC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35804

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all XRCC2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human XRCC2 (NP_005422.1).

Sequence:
MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKSEGGLEVEVLFIDT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for XRCC2 Antibody - BSA Free

XRCC2 Antibody

Immunohistochemistry: XRCC2 Antibody [NBP3-35804] -

Immunohistochemistry: XRCC2 Antibody [NBP3-35804] - Immunohistochemistry analysis of paraffin-embedded Rat lung using XRCC2 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
XRCC2 Antibody

Immunohistochemistry: XRCC2 Antibody [NBP3-35804] -

Immunohistochemistry: XRCC2 Antibody [NBP3-35804] - Immunohistochemistry analysis of paraffin-embedded Mouse spinal cord using XRCC2 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
XRCC2 Antibody

Western Blot: XRCC2 Antibody [NBP3-35804] -

Western Blot: XRCC2 Antibody [NBP3-35804] - Western blot analysis of various lysates using XRCC2 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.

Applications for XRCC2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: XRCC2

RAD51 is a eukaryotic homologue of E. coli RecA, a recombinase, and a component of the homologous recombination DNA repair pathway. RAD51 forms a nucleoprotein filament (through binding RAD52 and single stranded DNA that are exposed following double strand breaks) that initiates recombination. There are five human homologues of RAD51; XRCC2, XRCC3, RAD51B, RAD51C, RAD51D, and they interact among themselves to form one big complex or several smaller complexes. XRCC2 (X Ray Repair Cross Complementing 2), a component of the homologous recombination pathway, is essential for repairing the double strand DNA breaks by homologous recombination between sister chromatids.

Alternate Names

DKFZp781P0919, DNA repair protein XRCC2, X-ray repair complementing defective repair in Chinese hamster cells 2, X-ray repair cross-complementing protein 2, X-ray repair, complementing defective, repair in Chinese hamster

Gene Symbol

XRCC2

Additional XRCC2 Products

Product Documents for XRCC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for XRCC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for XRCC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review XRCC2 Antibody - BSA Free and earn rewards!

Have you used XRCC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies