YY2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57462

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QLGNDLEDQLALPDSIEDEHFQMTLASLSASAASTSTSTQSRSKKPSKKPSGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for YY2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: YY2 Antibody [NBP2-57462]

Immunocytochemistry/ Immunofluorescence: YY2 Antibody [NBP2-57462]

Immunocytochemistry/Immunofluorescence: YY2 Antibody [NBP2-57462] - Staining of human cell line HeLa shows localization to nuclear bodies.
Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462]

Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462]

Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462] - Staining in human testis and prostate tissues using anti-YY2 antibody. Corresponding YY2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462]

Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462]

Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462]

Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462]

Immunohistochemistry-Paraffin: YY2 Antibody [NBP2-57462] - Staining of human testis shows high expression.
YY2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: YY2 Antibody - BSA Free [NBP2-57462]

Chromatin Immunoprecipitation-exo-Seq: YY2 Antibody - BSA Free [NBP2-57462]

ChIP-Exo-Seq composite graph for Anti-YY2 (NBP2-57462) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for YY2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: YY2

YY2 functions as a multifunctional transcription factor that may exhibit positive and negative control on a largenumber of genes. May antagonize YY1 and function in development and differentiation

Alternate Names

transcription factor YY2, YY2 transcription factor, ZNF631

Gene Symbol

YY2

Additional YY2 Products

Product Documents for YY2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for YY2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for YY2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review YY2 Antibody - BSA Free and earn rewards!

Have you used YY2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...