ZAK Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35439

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-312 of human ZAK (NP_598407.1).

Sequence:
EEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZAK Antibody - BSA Free

ZAK Antibody

Immunocytochemistry/ Immunofluorescence: ZAK Antibody [NBP3-35439] -

Immunocytochemistry/ Immunofluorescence: ZAK Antibody [NBP3-35439] - Immunofluorescence analysis of L929 cells using ZAK Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ZAK Antibody

Western Blot: ZAK Antibody [NBP3-35439] -

Western Blot: ZAK Antibody [NBP3-35439] - Western blot analysis of various lysates using ZAK Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for ZAK Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZAK

ZAK is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Alternate Names

AZK, EC 2.7.11, EC 2.7.11.25, HCCS-4, Human cervical cancer suppressor gene 4 protein, Leucine zipper- and sterile alpha motif-containing kinase, mitogen-activated protein kinase kinase kinase MLT, mixed lineage kinase 7, mixed lineage kinase with a leucine zipper and a sterile alpha motif, Mixed lineage kinase-related kinase, mixed lineage kinase-related kinase MRK-beta, MLK7, mlklak, MLK-like mitogen-activated protein triple kinase, MLK-related kinase, MLT, MLTK, MRKcervical cancer suppressor gene 4 protein, pk, protein kinase, sterile alpha motif and leucine zipper containing kinase AZK, Sterile alpha motif- and leucine zipper-containing kinase AZK

Gene Symbol

ZAK

Additional ZAK Products

Product Documents for ZAK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZAK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZAK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZAK Antibody - BSA Free and earn rewards!

Have you used ZAK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...