ZDHHC17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68744

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZDHHC17 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFRCCGLFRPVIVDWTRQYTIEYDQISGSGYQL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZDHHC17 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZDHHC17 Antibody [NBP2-68744]

Immunocytochemistry/ Immunofluorescence: ZDHHC17 Antibody [NBP2-68744]

Immunocytochemistry/Immunofluorescence: ZDHHC17 Antibody [NBP2-68744] - Staining of human cell line U-2 OS shows localization to vesicles.

Applications for ZDHHC17 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZDHHC17

ZDHHC17 / HIP14 is a neuronal palmitoyl transferase. Palmitoylation is critical for trafficking and function of signaling molecules, neurotransmitter receptors, and synaptic scaffolding proteins in neurons. ZDHHC17 also causes cellular transformation. It has been shown that mRNA encoding ZDHHC17 is up-regulated in a number of types of human tumors, thus ZDHHC17 and other PATs (palmitoyl acyltransferases) are potential targets for new anticancer drugs.

Alternate Names

DHHC-17, EC 2.3.1, EC 2.3.1.-, HIP14HIP-14, huntingtin interacting protein 14, huntingtin interacting protein 3, Huntingtin interacting protein H, Huntingtin yeast partner H, Huntingtin-interacting protein 14, Huntingtin-interacting protein 3, Huntingtin-interacting protein H, HYPHHIP-3, KIAA0946HIP3, palmitoyltransferase ZDHHC17, Putative MAPK-activating protein PM11, Putative NF-kappa-B-activating protein 205, Zinc finger DHHC domain-containing protein 17, zinc finger, DHHC domain containing 17, zinc finger, DHHC-type containing 17

Gene Symbol

ZDHHC17

Additional ZDHHC17 Products

Product Documents for ZDHHC17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZDHHC17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZDHHC17 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZDHHC17 Antibody - BSA Free and earn rewards!

Have you used ZDHHC17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies